PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011076652.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family LBD
Protein Properties Length: 180aa    MW: 20156.7 Da    PI: 5.4708
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011076652.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260143.18.3e-4561051100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +Ca+Ck+lrr+CakdCv+apyfp+++p+kfa+vhk+FGasnv+k+l++lp ++r da+sslvyeA+arardPvyG+vg i+ lq+q+++l+ +la
  XP_011076652.1   6 PCASCKLLRRRCAKDCVFAPYFPSDDPHKFAIVHKVFGASNVSKMLQELPVQQRADAVSSLVYEANARARDPVYGCVGAISYLQNQVCELQMQLA 100
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  XP_011076652.1 101 VAQAE 105
                     99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.9745106IPR004883Lateral organ boundaries, LOB
PfamPF031952.7E-446103IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MGGNSPCASC KLLRRRCAKD CVFAPYFPSD DPHKFAIVHK VFGASNVSKM LQELPVQQRA  60
DAVSSLVYEA NARARDPVYG CVGAISYLQN QVCELQMQLA VAQAEILCIQ MQQQEQQQQA  120
ALAPSLLQLE PDIDDDDDDH KSYFLHPHHL LNFTSDNSSA NVIYDSFKKE SHLYPHDMVS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ0415522e-58KJ041552.1 Sesamum indicum clone TilSSR_12753 microsatellite Sesame_12753 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011076652.11e-132PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW31e-72LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A067FN823e-86A0A067FN82_CITSI; Uncharacterized protein
TrEMBLV4TH273e-86V4TH27_9R
STRINGVIT_13s0067g01880.t015e-85(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.14e-70LBD family protein